PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 274aa    MW: 29957.8 Da    PI: 8.2079
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009448genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
      Lus10009448 14 KGAWTKEEDQRLIDYIRSHGEGCWRSLPKSAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.21.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+ Ed+l+v+++ +lG++ W++Ia +++ gRt++++k++w+++
      Lus10009448  67 RGNFTESEDDLIVKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.18961IPR017930Myb domain
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2913108IPR009057Homeodomain-like
PfamPF002494.3E-161461IPR001005SANT/Myb domain
CDDcd001672.29E-111661No hitNo description
PROSITE profilePS5129427.50962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2765116IPR009057Homeodomain-like
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002498.8E-1667111IPR001005SANT/Myb domain
CDDcd001676.55E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR SHGEGCWRSL PKSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TESEDDLIVK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSLG  120
IDPQTHRPLN EKLSAGAADS VQLNRVIKTN GVLDFQFQTV KAESGEENNC SSSGMTTDDE  180
PSPPPAAAAK AVEEVDLNLE LTIGVGSSSS PPDLPANSGN SADSKARFRP VFRLCGGAVV  240
EEEVCLCWQL GVQEGSGGGC RCRFAGGRQS RYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534486.11e-111PREDICTED: transcription repressor MYB6
SwissprotQ388513e-99MYB6_ARATH; Transcription repressor MYB6
TrEMBLB9T8B71e-110B9T8B7_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0013s11360.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.13e-95myb domain protein 6